GSTA2_RAT P04903
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04903
Recommended name:Glutathione S-transferase alpha-2
EC number:EC:2.5.1.18
Alternative names:GST 1b-1b GST A2-2 Glutathione S-transferase Ya-2 (GST Ya2)
Cleaved into:
GeneID:494499
Gene names (primary ):Gsta2
Gene names (synonym ):
Gene names (ORF ):
Length:222
Mass:25,559
Sequence:MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF
Tissue specificity:
Induction:
Developmental stage:
Protein families: