GSTA1_RAT   P00502


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P00502

Recommended name:Glutathione S-transferase alpha-1 Curated

EC number:EC:2.5.1.18

Alternative names:13-hydroperoxyoctadecadienoate peroxidase By Similarity (EC:1.11.1.- By Similarity) . EC:1.11.1.- (UniProtKB | ENZYME | Rhea) By Similarity Androst-5-ene-3,17-dione isomerase By Similarity (EC:5.3.3.- By Similarity) . EC:5.3.3.- (UniProtKB | ENZYME | Rhea) By Similarity GST 1-1 GST 1a-1a GST A1-1 More alternative names

Cleaved into:

GeneID:24422

Gene names  (primary ):Gsta1

Gene names  (synonym ):

Gene names  (ORF ):

Length:222

Mass:25,607

Sequence:MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp