PI42C_RAT O88370
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88370
Recommended name：Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma Curated
EC number：EC:2.7.1.149
Alternative names：Phosphatidylinositol 5-phosphate 4-kinase type II gamma (PI(5)P 4-kinase type II gamma; PIP4KII-gamma)
Cleaved into：
GeneID：140607
Gene names (primary )：Pip4k2c
Gene names (synonym )：Pip5k2c
Gene names (ORF )：
Length：420
Mass：47,049
Sequence：MASSSVPPATAPAAAGGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFAIDDHDYLVSLTRSPPSETEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVENEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKVFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEGPVREEESEWDGDCNLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPEGGVFHGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFISNIFA
Tissue specificity：Widely expressed, with the most abundant expression in kidney. 1
Induction：
Developmental stage：
Protein families：