FGF18_RAT O88182
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88182
Recommended name：Fibroblast growth factor 18
EC number：
Alternative names：
Cleaved into：
GeneID：29369
Gene names (primary )：Fgf18
Gene names (synonym )：
Gene names (ORF )：
Length：207
Mass：23,951
Sequence：MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQTELQKPFKYTTVTKRSRRIRPTHPG
Tissue specificity：Mainly expressed in the lung. Not detected in brain, heart, liver, kidney and small intestine.
Induction：
Developmental stage：Expressed in several discrete regions at 14.5 dpc and 19.5 dpc but not 10.5 dpc. At 14.5 dpc, expressed in isthmus, pituitary, spinal cord, tongue, intervertebral disk, dorsal root ganglion and pelvis. At 19.5 dpc, expressed in lung and anterior pituitary.
Protein families：