EPCAM_RAT   O55159


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O55159

Recommended name:Epithelial cell adhesion molecule

EC number:

Alternative names:Epithelial glycoprotein 314 (EGP314) Protein D5.7A Tumor-associated calcium signal transducer 1

Cleaved into:

GeneID:171577

Gene names  (primary ):Epcam

Gene names  (synonym ):Tacstd1

Gene names  (ORF ):

Length:315

Mass:35,207

Sequence:MAPPKALAFGLLLAVVTATLAAAQKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVVLAVIAGIVVLVISTRKRSAKYEKAEIKEMGEIHRELNA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp