DHB3_RAT O54939
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O54939
Recommended name：17-beta-hydroxysteroid dehydrogenase type 3
EC number：
Alternative names：Estradiol 17-beta-dehydrogenase 2 (EC:1.1.1.62 By Similarity) . EC:1.1.1.62 (UniProtKB | ENZYME | Rhea) By Similarity Testicular 17-beta-hydroxysteroid dehydrogenase Testosterone 17-beta-dehydrogenase 3 Curated (EC:1.1.1.64 By Similarity) . EC:1.1.1.64 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into：
GeneID：117182
Gene names (primary )：Hsd17b3
Gene names (synonym )：Edh17b3
Gene names (ORF )：
Length：306
Mass：34,223
Sequence：MEQFLLSVGLLVCLVCLVKCVRFSRYLFLSFCKALPGSFLRSMGQWAVITGAGDGIGKAYSFELARHGLNVVLISRTLEKLQVISEEIERTTGSRVKVVQADFTREDIYDHIEEQLKGLEIGVLVNNVGMLPNLLPSHFLSTSGESQSVIHCNITSVVKMTQLVLKHMESRRRGLILNISSGVGVRPWPLYSLYSASKAFVCTFSKALNVEYRDKGIIIQVLTPYSVSTPMTKYLNTSRVTKTADEFVKESLKYVTIGAETCGCLAHEILAIILNLIPSRIFYSSTTQRFLLKQFSDYLKSNISNR
Tissue specificity：
Induction：
Developmental stage：
Protein families：