H17B6_RAT O54753
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O54753
Recommended name：17-beta-hydroxysteroid dehydrogenase type 6
EC number：EC:1.1.1.105
Alternative names：17-beta-HSD 6; 17-beta-HSD6
Cleaved into：
GeneID：286964
Gene names (primary )：Hsd17b6
Gene names (synonym )：Hsd17b9
Gene names (ORF )：
Length：317
Mass：36,145
Sequence：MWFYLVTLVGLYYLLRWYRERQVVSHLHDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELKSKTSDRLETVILDVTNTDSISAATQWVKEHVGDKGLWGLVNNAGVFQAFAYIEWCRPEDCMSIFQVNLIGLAQVTLSMLFLVKKARGRIVNVSSVLGRVALFGGFYSCSKYGVEAFSDVLRREIRDFGVKVSIIEPGSFKTRMTDAELIIEKTKKTWEATPEHIRESYGQQFFDDFCNTTRRELKKCSTNLSLVTDCMEHALTSKYPRTRYSAGWDARLFFIPLSYLPTSLVDCLLAISRRKPAQAV
Tissue specificity：Detected in prostate, liver and kidney. 1
Induction：
Developmental stage：Up-regulated by testosterone. Levels are very low in castrated male rats. 1
Protein families：