GPER1_RAT   O08878


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O08878

Recommended name:G-protein coupled estrogen receptor 1

EC number:

Alternative names:

Cleaved into:

GeneID:171104

Gene names  (primary ):Gper1

Gene names  (synonym ):Cmkrl2, Gper, Gpr30 1 Publication, Gpr41

Gene names  (ORF ):

Length:375

Mass:42,260

Sequence:MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLDEQYYDIAVLCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGLIWMASVSATLVPFTAVHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRALIRAHRHRGLRPRRQKALRMIFAVVLVFFICWLPENVFISVHLLQWAQPGDTPCKQSFRHAYPLTGHIVNLAAFSNSCLSPLIYSFLGETFRDKLRLYVAQKTSLPALNRFCHATLKAVIPDSTEQSDVKFSSAV

Tissue specificity:Expressed in the brain. Expressed in neurons of the hippocampus, hypothalamic paraventricular nucleus (PVN), supraoptic nucleus (SON) and the median eminence. Expressed in magnocellular neurosecretory cells (MNCs) which secrete oxytocin but not in MNCs which secrete vasopressin. Expressed in glial cells. Expressed in the nucleus ambiguous. Expressed in epithelial cells, in pachytene spermatocytes (PS) (at protein level). Expressed strongly in vascular endothelial cells and poorly in vascular smooth muscle cells (VSMC). Expressed in the brain, lung, pituitary gland, adrenal medulla, renal pelvis and ovary. Expressed in CA1 hippocampus. Expressed weakly in heart, skeletal muscle and kidney. 9 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp