VTM2L_HUMAN   Q96N03


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96N03

Recommended name:V-set and transmembrane domain-containing protein 2-like protein

EC number:

Alternative names:

Cleaved into:

GeneID:128434

Gene names  (primary ):VSTM2L

Gene names  (synonym ):C20orf102

Gene names  (ORF ):

Length:204

Mass:22349

Sequence:MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp