TIM50_HUMAN   Q3ZCQ8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3ZCQ8

Recommended name:Mitochondrial import inner membrane translocase subunit TIM50

EC number:

Alternative names:

Cleaved into:

GeneID:92609

Gene names  (primary ):TIMM50

Gene names  (synonym ):TIM50

Gene names  (ORF ):PRO1512

Length:353

Mass:39646

Sequence:MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP

Tissue specificity:Widely expressed. Expressed at higher level in brain, kidney and liver (at protein level). {ECO:0000269|PubMed:15044455, ECO:0000269|PubMed:16008839}.

Induction:

Developmental stage:

Protein families:TIM50 family


   💬 WhatsApp