TIM9_HUMAN   Q9Y5J7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y5J7

Recommended name:Mitochondrial import inner membrane translocase subunit Tim9

EC number:

Alternative names:

Cleaved into:

GeneID:26520

Gene names  (primary ):TIMM9

Gene names  (synonym ):TIM9 TIM9A TIMM9A

Gene names  (ORF ):

Length:89

Mass:10378

Sequence:MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR

Tissue specificity:Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle. {ECO:0000269|PubMed:10552927, ECO:0000269|PubMed:10611480}.

Induction:

Developmental stage:

Protein families:Small Tim family


   💬 WhatsApp