CH014_HUMAN   Q96KT6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96KT6

Recommended name:Putative uncharacterized protein encoded by LINC00208

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):LINC00208

Gene names  (synonym ):C8orf14 NCRNA00208

Gene names  (ORF ):

Length:92

Mass:9816

Sequence:MGQSLQEGRKQGRLLPAPSAHFLKHAHLASPSEVGGEPEIGSLCASHVLHMSPLYSVNLQVSPGSLTFHSLSLRSTSTRLQPQSTYIVGPLC

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp