CLLU1_HUMAN   Q5K131


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5K131

Recommended name:Chronic lymphocytic leukemia up-regulated protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):CLLU1

Gene names  (synonym ):

Gene names  (ORF ):

Length:121

Mass:14228

Sequence:MFNKCSFHSSIYRPAADNSASSLCAIICFLNLVIECDLETNSEINKLIIYLFSQNNRIRFSKLLLKILFYISIFSYPELMCEQYVTFIKPGIHYGQVSKKHIIYSTFLSKNFKFQLLRVCW

Tissue specificity:Specifically expressed in chronic lymphocytic leukemia (CLL) cells from patients without immunoglobulin heavy-chain hypermutations. Expression is detected in all CLL cells and levels are similar in patients before and after treatment. {ECO:0000269|PubMed:16339396, ECO:0000269|PubMed:17284524, ECO:0000269|PubMed:19212335}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp