XKRY_HUMAN   O14609


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O14609

Recommended name:Testis-specific XK-related protein, Y-linked

EC number:

Alternative names:

Cleaved into:

GeneID:9082

Gene names  (primary ):XKRY

Gene names  (synonym ):XKRY1

Gene names  (ORF ):

Length:159

Mass:18083

Sequence:MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVVTLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKIIPAWWVSMDAYLNHASICCHQFSCLSAVKLQLSNEELIRDTRWDIQSYTTDFSF

Tissue specificity:Testis specific.

Induction:

Developmental stage:

Protein families:XK family


   💬 WhatsApp