C4F30_HUMAN   Q9H0H9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H0H9

Recommended name:Putative cytochrome P450 family member 4F30

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):CYP4F30P

Gene names  (synonym ):C2orf14

Gene names  (ORF ):

Length:118

Mass:12413

Sequence:MVTPAGCLGGRNQGPREIPGTAFPCSSRAGQTGQAVSGAQVSSWRERQPFGGSRGPLHILGTDGNVDTTGKLGLVPTPPRIQKETKQGALCGMKPPFLPEALLTVWWLPFVAVSLCLF

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp