IGFL2_HUMAN   Q6UWQ7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UWQ7

Recommended name:Insulin growth factor-like family member 2

EC number:

Alternative names:

Cleaved into:

GeneID:147920

Gene names  (primary ):IGFL2

Gene names  (synonym ):

Gene names  (ORF ):UNQ645/PRO1275

Length:119

Mass:13248

Sequence:MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP

Tissue specificity:Detected in cerebellum, heart, placenta, spleen, stomach, testis and thymus. {ECO:0000269|PubMed:16890402}.

Induction:

Developmental stage:

Protein families:IGFL family


   💬 WhatsApp