CC152_HUMAN   Q4G0S7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4G0S7

Recommended name:Coiled-coil domain-containing protein 152

EC number:

Alternative names:

Cleaved into:

GeneID:100129792

Gene names  (primary ):CCDC152

Gene names  (synonym ):

Gene names  (ORF ):Chr5_400

Length:254

Mass:29979

Sequence:MDQSSEGCMKKISSVNLDKLINDFSQIEKKMVETNGKNNILDIQLEKSNCLLKVMQAKEVSIKEECATLHNIIKGLQQTIEYQQNLKGENEQLKISADLIKEKLKSHEQEYKNNIAKLVSEMKIKEEGYKKEISKLYQDMQRKVELNEEKHKELIEKKEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYQDSTVLPQSIYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVGKDSHLKRRRF

Tissue specificity:Detected in stomach. {ECO:0000269|PubMed:15809229}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp