ODAPH_HUMAN   Q17RF5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q17RF5

Recommended name:Odontogenesis associated phosphoprotein

EC number:

Alternative names:

Cleaved into:

GeneID:152816

Gene names  (primary ):ODAPH

Gene names  (synonym ):C4orf26

Gene names  (ORF ):

Length:130

Mass:15556

Sequence:MARRHCFSYWLLVCWLVVTVAEGQEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES

Tissue specificity:Highly expressed in placenta. {ECO:0000269|PubMed:22901946}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp