ARL4A_HUMAN   P40617


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P40617

Recommended name:ADP-ribosylation factor-like protein 4A

EC number:

Alternative names:

Cleaved into:

GeneID:10124

Gene names  (primary ):ARL4A

Gene names  (synonym ):ARL4

Gene names  (ORF ):

Length:200

Mass:22615

Sequence:MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Arf family


   💬 WhatsApp