INE1_HUMAN   O15225


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O15225

Recommended name:Putative inactivation escape 1 protein

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):INE1

Gene names  (synonym ):DXS6974E

Gene names  (ORF ):

Length:51

Mass:5365

Sequence:MSGPLSPVCSCPQLPFMLSPCHMHHHPGHVALSQTVSPASLLTQGLGLPQH

Tissue specificity:Highly expressed in pancreas, heart and liver followed by brain, placenta, lung, skeletal muscle and kidney. Mostly expressed in females. {ECO:0000269|PubMed:9244435}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp