CX001_HUMAN O96002
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O96002
Recommended name：Putative transmembrane protein CXorf1
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：CXorf1
Gene names (synonym )：
Gene names (ORF )：
Length：111
Mass：13452
Sequence：MYSRLFYLKSSYIIYFEPLFSNAIINILSFINSLASPLTIFCFALSAQALSTIFYFRIFIFIFHSWILLFHFYFTCSFKTYEHQHSKMVPAYRMQSPRALPRTYLYVWPYK
Tissue specificity：Brain. In the hippocampus it is mainly localized in the granular-cell layer of the dentate gyrus and in the CA2-CA3 subfields of Ammon's horn. {ECO:0000269|PubMed:9881668}.
Induction：
Developmental stage：
Protein families：