SNURF_HUMAN   Q9Y675


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y675

Recommended name:SNRPN upstream reading frame protein

EC number:

Alternative names:

Cleaved into:

GeneID:8926

Gene names  (primary ):SNURF

Gene names  (synonym ):

Gene names  (ORF ):

Length:71

Mass:8412

Sequence:MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELRQAFLAETPRGG

Tissue specificity:Expressed in heart, skeletal muscle and lymphoblasts (at protein level). Expressed in brain, pancreas, heart, liver, lung, kidney and skeletal muscle. {ECO:0000269|PubMed:10318933}.

Induction:

Developmental stage:

Protein families:SNURF family


   💬 WhatsApp