SI11A_HUMAN P58511
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P58511
Recommended name:Small integral membrane protein 11A
EC number:
Alternative names:
Cleaved into:
GeneID:102723553
Gene names (primary ):SMIM11A
Gene names (synonym ):C21orf51 FAM165B SMIM11
Gene names (ORF ):
Length:58
Mass:6886
Sequence:MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN
Tissue specificity:Expressed in heart, spleen, liver, stomach, muscle, lung, testis, skin, PBL and bone marrow.
Induction:
Developmental stage:
Protein families:SMIM11 family