LACRT_HUMAN   Q9GZZ8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9GZZ8

Recommended name:Extracellular glycoprotein lacritin

EC number:

Alternative names:

Cleaved into:

GeneID:90070

Gene names  (primary ):LACRT

Gene names  (synonym ):

Gene names  (ORF ):

Length:138

Mass:14246

Sequence:MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA

Tissue specificity:Expressed in secretory granules of many acinar cells in lacrimal gland and in scattered acinar cells of salivary glands.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp