AKAI1_HUMAN   P0CW23


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0CW23

Recommended name:A-kinase anchor protein inhibitor 1

EC number:

Alternative names:

Cleaved into:

GeneID:642597

Gene names  (primary ):AKAIN1

Gene names  (synonym ):C18orf42

Gene names  (ORF ):

Length:69

Mass:7848

Sequence:MVFAPGEKPGNEPEEVKLQNASKQIVQNAILQAVQQVSQESQRREERISDNRDHIQLGVGELTKKHEKK

Tissue specificity:Preferentially expressed in the neural tissues (PubMed:25653177). {ECO:0000269|PubMed:25653177}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp