ZNF67_HUMAN Q15940
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15940
Recommended name:Putative zinc finger protein 726P1
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):ZNF726P1
Gene names (synonym ):ZNF67 ZNF67P
Gene names (ORF ):
Length:193
Mass:22988
Sequence:MLSHKTQHKSIYTREKSYKCKKCGKTFNWSSILTNNKKIHTEQKPYKCEECGKAFKQHSTLTTHKIICAEEKLYRCEECGKAFCQPSTLTRYKRMHRRKKLYKCEECGKAFTQFSTLTKHKRIHTRGKHYKCEESGKAFIWSSGLTEHRRVHTRQKPYKCEECGKALIQFSTLTRHKRIHTGEKPNKSMWQTF
Tissue specificity:
Induction:
Developmental stage:
Protein families: