CT202_HUMAN   A1L168


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A1L168

Recommended name:Uncharacterized protein C20orf202

EC number:

Alternative names:

Cleaved into:

GeneID:400831

Gene names  (primary ):C20orf202

Gene names  (synonym ):

Gene names  (ORF ):

Length:122

Mass:13591

Sequence:MYKSKIPRAQNQVSVKVTPKNTEMKIAEEPSPSLGQTLEWLRKELSEMQIQDQSLLLTLRHLHSVLEELRADSAHWEDARSSGGTSPIRARAGSEGRGCQPVCSRGLAQLLRGEDSRRSSLP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp