DYDC1_HUMAN   Q8WWB3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WWB3

Recommended name:DPY30 domain-containing protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:143241

Gene names  (primary ):DYDC1

Gene names  (synonym ):DPY30D1

Gene names  (ORF ):RSD-9 RSD9

Length:177

Mass:20893

Sequence:MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL

Tissue specificity:Brain and testis. Accumulates during late stage of spermiogenesis. {ECO:0000269|PubMed:19545932}.

Induction:

Developmental stage:

Protein families:Dpy-30 family


   💬 WhatsApp