DNJB3_HUMAN   Q8WWF6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WWF6

Recommended name:DnaJ homolog subfamily B member 3

EC number:

Alternative names:

Cleaved into:

GeneID:414061

Gene names  (primary ):DNAJB3

Gene names  (synonym ):HCG3

Gene names  (ORF ):

Length:145

Mass:16559

Sequence:MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQ

Tissue specificity:Expressed in sperm (at protein level). {ECO:0000269|PubMed:18184612}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp