KXDL1_HUMAN   Q9BQD3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BQD3

Recommended name:KxDL motif-containing protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:79036

Gene names  (primary ):KXD1

Gene names  (synonym ):C19orf50

Gene names  (ORF ):

Length:176

Mass:19668

Sequence:MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQPGSPAINGRSQTDDEEMTGE

Tissue specificity:

Induction:

Developmental stage:

Protein families:KXD1 family


   💬 WhatsApp