OSR1_HUMAN   Q8TAX0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TAX0

Recommended name:Protein odd-skipped-related 1

EC number:

Alternative names:

Cleaved into:

GeneID:130497

Gene names  (primary ):OSR1

Gene names  (synonym ):ODD

Gene names  (ORF ):

Length:266

Mass:29611

Sequence:MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKPRFDFANLALAATQEDPAKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC

Tissue specificity:Expressed in adult colon, small intestine, prostate, testis, and fetal lung. {ECO:0000269|PubMed:12119563}.

Induction:

Developmental stage:

Protein families:Odd C2H2-type zinc-finger protein family


   💬 WhatsApp