TAFA2_HUMAN   Q8N3H0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N3H0

Recommended name:Chemokine-like protein TAFA-2

EC number:

Alternative names:

Cleaved into:

GeneID:338811

Gene names  (primary ):TAFA2

Gene names  (synonym ):FAM19A2

Gene names  (ORF ):

Length:131

Mass:14620

Sequence:MSKRYLQKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH

Tissue specificity:Brain-specific. {ECO:0000269|PubMed:15028294}.

Induction:

Developmental stage:

Protein families:TAFA family


   💬 WhatsApp