TEX50_HUMAN   A0A1B0GTY4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0A1B0GTY4

Recommended name:Testis-expressed protein 50

EC number:

Alternative names:

Cleaved into:

GeneID:730159

Gene names  (primary ):TEX50

Gene names  (synonym ):

Gene names  (ORF ):

Length:177

Mass:20847

Sequence:MSNQRLPLIFSLLFICFFGESFCICDGTVWTKVGWEILPEEVHYWKVKGSPSHCLPYLLDKLCCDFANMDIFQGCLYLIYNLLQAVFFVLFVLSVHYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp