TEX46_HUMAN   H3BTG2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:H3BTG2

Recommended name:Testis-expressed protein 46

EC number:

Alternative names:

Cleaved into:

GeneID:729059

Gene names  (primary ):TEX46

Gene names  (synonym ):C1orf234

Gene names  (ORF ):

Length:121

Mass:14053

Sequence:MSLHGILASAGTIGAVAAWLMSYKPALFGFLFLLLLLSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Tissue specificity:Testis-specific. {ECO:0000305}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp