TEX43_HUMAN   Q6ZNM6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6ZNM6

Recommended name:Testis-expressed protein 43

EC number:

Alternative names:

Cleaved into:

GeneID:389320

Gene names  (primary ):TEX43

Gene names  (synonym ):C5orf48

Gene names  (ORF ):

Length:134

Mass:15452

Sequence:MASGKDTCPTLPKLTNNCSDESLYKSANKYEEIHLPRFSLKQGMIPRRYVMPWKENMIFRNVNLKQAEVCGIHTGPLEDSLFLNHSERLCHGEDRKVVFQKGPPEIKIADMPLHSPLSRYQSTVISHGFRRRLV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp