T183B_HUMAN Q1AE95
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q1AE95
Recommended name:Transmembrane protein 183B
EC number:
Alternative names:
Cleaved into:
GeneID:653659
Gene names (primary ):TMEM183B
Gene names (synonym ):C1orf37-dup
Gene names (ORF ):
Length:376
Mass:42940
Sequence:MARGPGPLGRPRPDTVAMPKRGKRLKFRAHDACSGRVTVADYADSDLAVVRSGRVKKAVANAVRQEVKSLCGLEASQVPAEEALSGAGEPYDIIDSSDEMDAQEENIHERTVSRKKKSKRHKEELDGAGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPLRLRPESMEKLHCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCTGGLQPPVQYEDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGVQVILDPVHSVRLFDWWHPQYPFSLRA
Tissue specificity:Expressed in brain, lung, pancreas, thymus, intestine and blood. Not detected in heart, placenta, liver, muscle, kidney, spleen, prostate, testis, ovary and colon. {ECO:0000269|PubMed:16644869}.
Induction:
Developmental stage:
Protein families:TMEM183 family