T170B_HUMAN   Q5T4T1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5T4T1

Recommended name:Transmembrane protein 170B

EC number:

Alternative names:

Cleaved into:

GeneID:100113407

Gene names  (primary ):TMEM170B

Gene names  (synonym ):

Gene names  (ORF ):

Length:132

Mass:14360

Sequence:MKAEGGDHSMINLSVQQVLSLWAHGTVLRNLTEMWYWIFLWALFSSLFVHGAAGVLMFVMLQRHRQGRVISVIAVSIGFLASVTGAMITSAAVAGIYRVAGKNMAPLEALVWGVGQTVLTLIISFSRILATL

Tissue specificity:Expressed in normal breast tissues. Down-regulated in breast cancer cells (at protein level) (PubMed:29367600). {ECO:0000269|PubMed:29367600}.

Induction:

Developmental stage:

Protein families:TMEM170 family


   💬 WhatsApp