T106A_HUMAN Q96A25
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96A25
Recommended name：Transmembrane protein 106A
EC number：
Alternative names：
Cleaved into：
GeneID：113277
Gene names (primary )：TMEM106A
Gene names (synonym )：
Gene names (ORF )：
Length：262
Mass：28920
Sequence：MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCEGTADASFVTCPTCQGSGKIPQELEKQLVALIPYGDQRLKPKHTKLFVFLAVLICLVTSSFIVFFLFPRSVIVQPAGLNSSTVAFDEADIYLNITNILNISNGNYYPIMVTQLTLEVLHLSLVVGQVSNNLLLHIGPLASEQMFYAVATKIRDENTYKICTWLEIKVHHVLLHIQGTLTCSYLSHSEQLVFQSYEYVDCRGNASVPHQLTPHPP
Tissue specificity：Expressed in renal cells (at protein level) (PubMed:29131025). Expressed in epithelial cells (PubMed:30456879). {ECO:0000269|PubMed:29131025, ECO:0000269|PubMed:30456879}.
Induction：
Developmental stage：
Protein families：TMEM106 family