NFE4_HUMAN   Q86UQ8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86UQ8

Recommended name:Transcription factor NF-E4

EC number:

Alternative names:

Cleaved into:

GeneID:58160

Gene names  (primary ):NFE4

Gene names  (synonym ):

Gene names  (ORF ):

Length:179

Mass:19019

Sequence:MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPQGHAPSAEDPTGTWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG

Tissue specificity:Specifically expressed in fetal liver, cord blood and bone marrow. Also expressed in the K562 and HEL cell lines, which constitutively express the fetal globin genes. {ECO:0000269|PubMed:11003662}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp