RAB32_HUMAN Q13637
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13637
Recommended name:Ras-related protein Rab-32
EC number:
Alternative names:
Cleaved into:
GeneID:10981
Gene names (primary ):RAB32
Gene names (synonym ):
Gene names (ORF ):
Length:225
Mass:24997
Sequence:MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Tissue specificity:Widely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung. {ECO:0000269|PubMed:11784320, ECO:0000269|PubMed:12186851}.
Induction:
Developmental stage:
Protein families:Small GTPase superfamily, Rab family