TM234_HUMAN   Q8WY98


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WY98

Recommended name:Transmembrane protein 234

EC number:

Alternative names:

Cleaved into:

GeneID:56063

Gene names  (primary ):TMEM234

Gene names  (synonym ):C1orf91

Gene names  (ORF ):PP1065 UNQ548/PRO1105

Length:164

Mass:17601

Sequence:MAASLGQVLALVLVAALWGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITSSVPWTAELQLHGKGQLQTLSQKCKREASGTQSERFG

Tissue specificity:

Induction:

Developmental stage:

Protein families:TMEM234 family


   💬 WhatsApp