TM230_HUMAN Q96A57
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96A57
Recommended name：Transmembrane protein 230
EC number：
Alternative names：
Cleaved into：
GeneID：29058
Gene names (primary )：TMEM230
Gene names (synonym )：C20orf30
Gene names (ORF )：HSPC274 UNQ2432/PRO4992
Length：120
Mass：13188
Sequence：MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Tissue specificity：
Induction：
Developmental stage：
Protein families：TMEM134/TMEM230 family