TM107_HUMAN   Q6UX40


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UX40

Recommended name:Transmembrane protein 107

EC number:

Alternative names:

Cleaved into:

GeneID:84314

Gene names  (primary ):TMEM107

Gene names  (synonym ):

Gene names  (ORF ):DC20 UNQ638/PRO1268

Length:140

Mass:15503

Sequence:MGRVSGLVPSRFLTLLAHLVVVITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAALSVTLGLFAVELAGFLSGVSMFNSTQSLISIGAHCSASVALSFFIFERWECTTYWYIFVFCSALPAVTEMALFVTVFGLKKKPF

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp