CT027_HUMAN   Q9GZN8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9GZN8

Recommended name:UPF0687 protein C20orf27

EC number:

Alternative names:

Cleaved into:

GeneID:54976

Gene names  (primary ):C20orf27

Gene names  (synonym ):

Gene names  (ORF ):

Length:174

Mass:19291

Sequence:MAAANKGNKPRVRSIRFAAGHDAEGSHSHVHFDEKLHDSVVMVTQESDSSFLVKVGFLKILHRYEITFTLPPVHRLSKDVREAPVPSLHLKLLSVVPVPEGYSVKCEYSAHKEGVLKEEILLACEGGTGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEHSDWHGFD

Tissue specificity:

Induction:

Developmental stage:

Protein families:UPF0687 family


   💬 WhatsApp