CF120_HUMAN   Q7Z4R8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7Z4R8

Recommended name:UPF0669 protein C6orf120

EC number:

Alternative names:

Cleaved into:

GeneID:387263

Gene names  (primary ):C6orf120

Gene names  (synonym ):

Gene names  (ORF ):

Length:191

Mass:20772

Sequence:MAAPRGRAAPWTTALLLLLASQVLSPGSCADEEEVPEEWVLLHVVQGQIGAGNYSYLRLNHEGKIVLRMRSLKGDADLYVSASSLHPSFDDYELQSATCGPDAVSIPAHFRRPVGIGVYGHPSHLESEFEMKVYYDGTVEQHPFGEAAYPADGADAGQKHAGAPEDASQEEESVLWTILISILKLVLEILF

Tissue specificity:Mainly expressed in hepatocytes and some weak expression in germinal center cells of lymph nodes. {ECO:0000269|PubMed:22340178}.

Induction:

Developmental stage:

Protein families:UPF0669 family


   💬 WhatsApp