XP32_HUMAN Q5T750
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5T750
Recommended name：Skin-specific protein 32
EC number：
Alternative names：
Cleaved into：
GeneID：100129271
Gene names (primary )：XP32
Gene names (synonym )：C1orf68
Gene names (ORF )：
Length：250
Mass：26238
Sequence：MCDQQKQPQFPPSCVKGSGLGAGQGSNGASVKCPVPCQTQTVCVTGPAPCPTQTYVKYQVPCQTQTYVKCPAPCQRTYVKYPTPCQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPCQSYYVQAPASGSTSQYCVTDPCSAPCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSGCCCLGIIPMRSRGPACCDHEDDCCC
Tissue specificity：Expressed at high levels in normal and psoriatic skin, but not in normal keratinocytes, A-431 cells, or any of the other cell lines or tissues tested. {ECO:0000269|PubMed:9344646}.
Induction：
Developmental stage：
Protein families：