COTL1_HUMAN   Q14019


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14019

Recommended name:Coactosin-like protein

EC number:

Alternative names:

Cleaved into:

GeneID:23406

Gene names  (primary ):COTL1

Gene names  (synonym ):CLP

Gene names  (ORF ):

Length:142

Mass:15945

Sequence:MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE

Tissue specificity:Widely expressed with highest levels in placenta, lung, kidney and peripheral blood leukocytes and lower levels in brain, liver and pancreas. {ECO:0000269|PubMed:11583571}.

Induction:

Developmental stage:

Protein families:Actin-binding proteins ADF family, Coactosin subfamily


   💬 WhatsApp