YPEL3_HUMAN   P61236


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P61236

Recommended name:Protein yippee-like 3

EC number:

Alternative names:

Cleaved into:

GeneID:83719

Gene names  (primary ):YPEL3

Gene names  (synonym ):

Gene names  (ORF ):FKSG5

Length:119

Mass:13608

Sequence:MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:15556292}.

Induction:

Developmental stage:

Protein families:Yippee family


   💬 WhatsApp