APRG1_HUMAN Q8IVJ8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8IVJ8
Recommended name：AP20 region protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：339883
Gene names (primary )：APRG1
Gene names (synonym )：C3orf35
Gene names (ORF )：
Length：170
Mass：18525
Sequence：MKTMATRKRCKLSRTGPEFENVIKRLLCARTFHTRIGGDLTHGIINRGRRANAEQMGLQGSAQHFNIFPLDLWTQGKKTEVQKREGTDSIPAAGRSGTANQPSIAPHRCLFSRGITALDGLKRGRGCNGAAHLVRGDAWKTKLGEPWVSIALALAGPGAILILELSWFLG
Tissue specificity：Isoform 1 is expressed at high levels in the pancreas and placenta. Isoform 2 is expressed at high levels in the kidney. {ECO:0000269|PubMed:12543795}.
Induction：
Developmental stage：
Protein families：