TB15B_HUMAN   P0CG35


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0CG35

Recommended name:Thymosin beta-15B

EC number:

Alternative names:

Cleaved into:

GeneID:11013

Gene names  (primary ):TMSB15B

Gene names  (synonym ):

Gene names  (ORF ):

Length:45

Mass:5229

Sequence:MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Tissue specificity:Expressed in colon and colon cancer tissue. {ECO:0000269|PubMed:19296525}.

Induction:

Developmental stage:

Protein families:Thymosin beta family


   💬 WhatsApp